Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.0: automated matches [195065] (1 protein) not a true family |
Protein automated matches [195066] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries) |
Domain d6ckva_: 6ckv A: [351832] automated match to d2ponb_ |
PDB Entry: 6ckv (more details)
SCOPe Domain Sequences for d6ckva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ckva_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ptdkelvaqakalgreyvharllraglswsaperaapvpgrlaevaavllrlgdelemir psvyrnvarqlhislqservvtdaflavaghifsagitwgkvvslyavaaglavdavrqa qpamvhalvdalgefvrktlatwlrrrggwtdvlkc
Timeline for d6ckva_: