Lineage for d6ckva_ (6ckv A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2627094Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 2627095Protein automated matches [195066] (5 species)
    not a true protein
  7. 2627101Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)
  8. 2627126Domain d6ckva_: 6ckv A: [351832]
    automated match to d2ponb_

Details for d6ckva_

PDB Entry: 6ckv (more details)

PDB Description: solution nmr structure of human bok
PDB Compounds: (A:) Bcl-2-related ovarian killer protein

SCOPe Domain Sequences for d6ckva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ckva_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptdkelvaqakalgreyvharllraglswsaperaapvpgrlaevaavllrlgdelemir
psvyrnvarqlhislqservvtdaflavaghifsagitwgkvvslyavaaglavdavrqa
qpamvhalvdalgefvrktlatwlrrrggwtdvlkc

SCOPe Domain Coordinates for d6ckva_:

Click to download the PDB-style file with coordinates for d6ckva_.
(The format of our PDB-style files is described here.)

Timeline for d6ckva_: