Lineage for d6ckia1 (6cki A:72-371)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. Domain d6ckia1: 6cki A:72-371 [351829]
    Other proteins in same PDB: d6ckia2
    automated match to d2hw6a_
    complexed with fzj, zn

Details for d6ckia1

PDB Entry: 6cki (more details), 2.9499999999999997 Å

PDB Description: co-crystal structure of mnk2 in complex with inhibitor
PDB Compounds: (A:) MAP kinase-interacting serine/threonine-protein kinase 2

SCOPe Domain Sequences for d6ckia1:

Sequence, based on SEQRES records: (download)

>d6ckia1 d.144.1.0 (A:72-371) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfreve
mlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdvas
aldflhnkgiahrdlkpenilcehpnqvspvkicdfglgsgiklngdcspistpelltpc
gsaeymapevveafseeasiydkrcdlwslgvilyillsgyppfvgrcgsdcgwdrgeac
pacqnmlfesiqegkyefpdkdwahiscaakdliskllvrdakqrlsaaqvlqhpwvqgc

Sequence, based on observed residues (ATOM records): (download)

>d6ckia1 d.144.1.0 (A:72-371) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfreve
mlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdvas
aldflhnkgiahrdlkpenilcehpnqvspvkicdfggsaeymapevveafseeasiydk
rcdlwslgvilyillsgyppfvgrccgacpacqnmlfesiqegkyefpdkdwahiscaak
dliskllvrdakqrlsaaqvlqhpwvqgc

SCOPe Domain Coordinates for d6ckia1 are not available.

Timeline for d6ckia1:

Domains from same chain:
(mouse over for more information)
d6ckia2