Lineage for d5muqb1 (5muq B:1-112)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. Domain d5muqb1: 5muq B:1-112 [351807]
    Other proteins in same PDB: d5muqa1, d5muqa2, d5muqb2, d5muqh1, d5muqh2, d5muql2
    automated match to d3okla1
    complexed with imd, zn

Details for d5muqb1

PDB Entry: 5muq (more details), 2.62 Å

PDB Description: crystal structure of dc8e8 fab at ph 7.0 containing a zn atom
PDB Compounds: (B:) antibody kappa light chain

SCOPe Domain Sequences for d5muqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5muqb1 b.1.1.0 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldik

SCOPe Domain Coordinates for d5muqb1 are not available.

Timeline for d5muqb1:

Domains from same chain:
(mouse over for more information)
d5muqb2
Domains from other chains:
(mouse over for more information)
d5muqa1, d5muqa2, d5muqh1, d5muqh2, d5muql1, d5muql2