Lineage for d5xzua_ (5xzu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (131 species)
    not a true protein
  7. 2832476Species Bispora sp. [TaxId:554688] [349356] (2 PDB entries)
  8. 2832479Domain d5xzua_: 5xzu A: [351800]
    automated match to d3u7ba_
    complexed with nag

Details for d5xzua_

PDB Entry: 5xzu (more details), 1.7 Å

PDB Description: crystal structure of gh10 xylanase from bispora. sp mey-1 with xylobiose
PDB Compounds: (A:) Beta-xylanase

SCOPe Domain Sequences for d5xzua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xzua_ c.1.8.0 (A:) automated matches {Bispora sp. [TaxId: 554688]}
wglnnaaradgklwfgtaadipgleqddryymkeynnthdfggttpanimkfmftepeqn
vfnftgaqefldiafashklvrchnliwqselptwvtnpttnwtnetlskvlqnhvytlv
shfgdqcyswdvvnealsddpagsyqnniwfdtigpeyvamafeyaekavkdhklnvkly
yndynieypgpkstaaqnivkelkarniqidgvgleshfiagetpsqatqitnmadftsl
didvavteldvrlylppnatseaqqvadyyatvaacaatercigitvwdfddtyswvpst
fagqgyadlffqpdgpntplvkkaaydgclqalq

SCOPe Domain Coordinates for d5xzua_:

Click to download the PDB-style file with coordinates for d5xzua_.
(The format of our PDB-style files is described here.)

Timeline for d5xzua_: