Lineage for d5wbgd_ (5wbg D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2331534Protein automated matches [190068] (8 species)
    not a true protein
  7. 2331553Species Human (Homo sapiens) [TaxId:9606] [189507] (50 PDB entries)
  8. 3051725Domain d5wbgd_: 5wbg D: [351787]
    automated match to d5xxia_
    complexed with 9zj, cm5, hem, zaz

Details for d5wbgd_

PDB Entry: 5wbg (more details), 2.99 Å

PDB Description: crystal structure of human cytochrome p450 2b6 (y226h/k262r) in complex with an analog of a drug efavirenz
PDB Compounds: (D:) Cytochrome P450 2B6

SCOPe Domain Sequences for d5wbgd_:

Sequence, based on SEQRES records: (download)

>d5wbgd_ a.104.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveaire
alvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeri
qeeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtf
slissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlid
tyllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyr
eieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdt
evflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiarael
flffttilqnfsmaspvapedidltpqecgvgkipptyqirflpr

Sequence, based on observed residues (ATOM records): (download)

>d5wbgd_ a.104.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveaire
alvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeri
qeeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtf
slissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlid
tyllhmekeksahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyre
ieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdte
vflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelf
lffttilqnfsmaspvapedidltpqecgvgkipptyqirflpr

SCOPe Domain Coordinates for d5wbgd_:

Click to download the PDB-style file with coordinates for d5wbgd_.
(The format of our PDB-style files is described here.)

Timeline for d5wbgd_:

  • d5wbgd_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-03