SCOPe 2.08: Domain d5mthb2: 5mth B:113-218

Lineage for d5mthb2 (5mth B:113-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5mthb2: 5mth B:113-218 [351774]
   Other proteins in same PDB: d5mtha_, d5mthb1, d5mthh_, d5mthl1
   automated match to d3okka2
   complexed with act

Details for d5mthb2

PDB Entry: 5mth, 1.73 Å

PDB Description: structure of dc8e8 fab at ph 6.5 crystallized in spacegroup p21

PDB Compounds: (B:) antibody fab light chain

SCOPe Domain Sequences for d5mthb2:

Sequence; same for both SEQRES and ATOM records:

>d5mthb2 b.1.1.2 (B:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d5mthb2:

• d5mthb2 first appeared in SCOPe 2.07