Lineage for d5mthb1 (5mth B:1-112)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. Domain d5mthb1: 5mth B:1-112 [351773]
    Other proteins in same PDB: d5mtha_, d5mthb2, d5mthh_, d5mthl2
    automated match to d3okla1
    complexed with act

Details for d5mthb1

PDB Entry: 5mth (more details), 1.7300000000000002 Å

PDB Description: structure of dc8e8 fab at ph 6.5 crystallized in spacegroup p21
PDB Compounds: (B:) antibody fab light chain

SCOPe Domain Sequences for d5mthb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mthb1 b.1.1.0 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldik

SCOPe Domain Coordinates for d5mthb1 are not available.

Timeline for d5mthb1:

Domains from same chain:
(mouse over for more information)
d5mthb2
Domains from other chains:
(mouse over for more information)
d5mtha_, d5mthh_, d5mthl1, d5mthl2