Lineage for d5mvjl2 (5mvj L:113-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753083Domain d5mvjl2: 5mvj L:113-219 [351772]
    Other proteins in same PDB: d5mvja_, d5mvjb1, d5mvjc_, d5mvjd1, d5mvje_, d5mvjf1, d5mvjh_, d5mvjl1
    automated match to d3okka2
    complexed with cl

Details for d5mvjl2

PDB Entry: 5mvj (more details), 2.5 Å

PDB Description: structure of dc8e8 fab at ph 6.5 crystallized in space-group p1
PDB Compounds: (L:) antibody kappa chain

SCOPe Domain Sequences for d5mvjl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mvjl2 b.1.1.2 (L:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d5mvjl2:

Click to download the PDB-style file with coordinates for d5mvjl2.
(The format of our PDB-style files is described here.)

Timeline for d5mvjl2: