Lineage for d5mvjl1 (5mvj L:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760860Domain d5mvjl1: 5mvj L:1-112 [351771]
    Other proteins in same PDB: d5mvja_, d5mvjb2, d5mvjc_, d5mvjd2, d5mvje_, d5mvjf2, d5mvjh_, d5mvjl2
    automated match to d3okla1
    complexed with cl

Details for d5mvjl1

PDB Entry: 5mvj (more details), 2.5 Å

PDB Description: structure of dc8e8 fab at ph 6.5 crystallized in space-group p1
PDB Compounds: (L:) antibody kappa chain

SCOPe Domain Sequences for d5mvjl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mvjl1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldik

SCOPe Domain Coordinates for d5mvjl1:

Click to download the PDB-style file with coordinates for d5mvjl1.
(The format of our PDB-style files is described here.)

Timeline for d5mvjl1: