SCOPe 2.08: Domain d5vm0b_: 5vm0 B:

Lineage for d5vm0b_ (5vm0 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5vm0b_: 5vm0 B: [351765]
   automated match to d4y5va_
   complexed with 9eg, edo

Details for d5vm0b_

PDB Entry: 5vm0, 1.79 Å

PDB Description: the hapten triclocarban bound to the single domain camelid nanobody vhh t9

PDB Compounds: (B:) Camelid Nanobody VHH T9

SCOPe Domain Sequences for d5vm0b_:

Sequence; same for both SEQRES and ATOM records:

>d5vm0b_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
aevqlvesggglvqtgdslrlscaasgrtytpyamawfrqapgkerefvagiggidgtaa
yadsvrgratisrdsakktvylqmnslkpedtavyscatrasmqvltsprvypiwgrgtq
vtvsspg

Timeline for d5vm0b_:

• d5vm0b_ first appeared in SCOPe 2.07