![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
![]() | Domain d5vm0b_: 5vm0 B: [351765] automated match to d4y5va_ complexed with 9eg, edo |
PDB Entry: 5vm0 (more details), 1.79 Å
SCOPe Domain Sequences for d5vm0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vm0b_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]} aevqlvesggglvqtgdslrlscaasgrtytpyamawfrqapgkerefvagiggidgtaa yadsvrgratisrdsakktvylqmnslkpedtavyscatrasmqvltsprvypiwgrgtq vtvsspg
Timeline for d5vm0b_: