SCOPe 2.08: Domain d5vm4f1: 5vm4 F:5-129

Lineage for d5vm4f1 (5vm4 F:5-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5vm4f1: 5vm4 F:5-129 [351763]
   Other proteins in same PDB: d5vm4a2, d5vm4b2, d5vm4c2, d5vm4d2, d5vm4e2, d5vm4f2, d5vm4g2, d5vm4h2, d5vm4i2, d5vm4j2, d5vm4k2, d5vm4l2
   automated match to d4w81a_
   complexed with act, fmt

Details for d5vm4f1

PDB Entry: 5vm4, 1.9 Å

PDB Description: the apo form of the triclocarban-binding single domain camelid nanobody vhh t10

PDB Compounds: (F:) single domain camelid nanobody VHH T10

SCOPe Domain Sequences for d5vm4f1:

Sequence; same for both SEQRES and ATOM records:

>d5vm4f1 b.1.1.1 (F:5-129) automated matches {Llama (Lama glama) [TaxId: 9844]}
klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
tqvtv

Timeline for d5vm4f1:

• d5vm4f1 first appeared in SCOPe 2.07