Lineage for d5vm6a1 (5vm6 A:4-129)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) 
Domain d5vm6a1: 5vm6 A:4-129 [351761]
Other proteins in same PDB: d5vm6a2
automated match to d4w81a_
complexed with 9eg, na, so4
Details for d5vm6a1
PDB Entry: 5vm6 (more details), 1.5 Å
PDB Description: the hapten triclocarban bound to the single domain camelid nanobody vhh t10
PDB Compounds: (A:) single domain camelid nanobody VHH T10SCOPe Domain Sequences for d5vm6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vm6a1 b.1.1.1 (A:4-129) automated matches {Llama (Lama glama) [TaxId: 9844]}
vklqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwya
dsvkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgq
gtqvtv
SCOPe Domain Coordinates for d5vm6a1:
Click to download the PDB-style file with coordinates for d5vm6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5vm6a1:
- d5vm6a1 first appeared in SCOPe 2.07
View in 3D
