Lineage for d5ymta_ (5ymt A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390760Species Human rotavirus a [TaxId:10941] [187643] (14 PDB entries)
  8. 2390792Domain d5ymta_: 5ymt A: [351754]
    automated match to d5gj6a_
    complexed with gal, glc, nag

Details for d5ymta_

PDB Entry: 5ymt (more details), 2.2 Å

PDB Description: functional and structural characterization of p[19] rotavirus vp8* interaction with histo-blood group antigens
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d5ymta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ymta_ b.29.1.0 (A:) automated matches {Human rotavirus a [TaxId: 10941]}
vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
ttdysttsnlneisvttyaefyiiprsqeskcteyintgl

SCOPe Domain Coordinates for d5ymta_:

Click to download the PDB-style file with coordinates for d5ymta_.
(The format of our PDB-style files is described here.)

Timeline for d5ymta_: