SCOPe 2.08: Domain d5mvjf1: 5mvj F:1-112

Lineage for d5mvjf1 (5mvj F:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5mvjf1: 5mvj F:1-112 [351743]
   Other proteins in same PDB: d5mvja_, d5mvjb2, d5mvjc_, d5mvjd2, d5mvje_, d5mvjf2, d5mvjh_, d5mvjl2
   automated match to d3okla1
   complexed with cl

Details for d5mvjf1

PDB Entry: 5mvj, 2.5 Å

PDB Description: structure of dc8e8 fab at ph 6.5 crystallized in space-group p1

PDB Compounds: (F:) antibody kappa chain

SCOPe Domain Sequences for d5mvjf1:

Sequence; same for both SEQRES and ATOM records:

>d5mvjf1 b.1.1.0 (F:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldik

Timeline for d5mvjf1:

• d5mvjf1 first appeared in SCOPe 2.07