| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Human rotavirus a [TaxId:10941] [187643] (15 PDB entries) |
| Domain d5ymsf_: 5yms F: [351742] automated match to d5gj6a_ complexed with a2g, gal, nag |
PDB Entry: 5yms (more details), 2.1 Å
SCOPe Domain Sequences for d5ymsf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ymsf_ b.29.1.0 (F:) automated matches {Human rotavirus a [TaxId: 10941]}
vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
Timeline for d5ymsf_: