Lineage for d5ymsf_ (5yms F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781109Species Human rotavirus a [TaxId:10941] [187643] (15 PDB entries)
  8. 2781135Domain d5ymsf_: 5yms F: [351742]
    automated match to d5gj6a_
    complexed with a2g, gal, nag

Details for d5ymsf_

PDB Entry: 5yms (more details), 2.1 Å

PDB Description: structural basis of glycan specificity and identification of a novel glycan binding cavity in human p[19] rotavirus
PDB Compounds: (F:) Outer capsid protein VP4

SCOPe Domain Sequences for d5ymsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ymsf_ b.29.1.0 (F:) automated matches {Human rotavirus a [TaxId: 10941]}
vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
ttdysttsnlneisvttyaefyiiprsqeskcteyintgl

SCOPe Domain Coordinates for d5ymsf_:

Click to download the PDB-style file with coordinates for d5ymsf_.
(The format of our PDB-style files is described here.)

Timeline for d5ymsf_: