SCOP 1.69: Domain d2at1c1: 2at1 C:1-150

Lineage for d2at1c1 (2at1 C:1-150)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)

7. Species Escherichia coli [TaxId:562] [53674] (36 PDB entries)

8. Domain d2at1c1: 2at1 C:1-150 [35174]
   Other proteins in same PDB: d2at1b1, d2at1b2, d2at1d1, d2at1d2

Details for d2at1c1

PDB Entry: 2at1, 2.8 Å

PDB Description: crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral ph

SCOP Domain Sequences for d2at1c1:

Sequence; same for both SEQRES and ATOM records:

>d2at1c1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqqteg

Timeline for d2at1c1:

• d2at1c1 first appeared (with stable ids) in SCOP 1.55
  
• d2at1c1 appears in SCOP 1.67
  
• d2at1c1 appears in SCOP 1.71
  
• d2at1c1 appears in the current release, SCOPe 2.08