Lineage for d5ymsd_ (5yms D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375499Species Human rotavirus a [TaxId:10941] [187643] (13 PDB entries)
  8. 3051670Domain d5ymsd_: 5yms D: [351732]
    automated match to d5gj6a_
    complexed with a2g, gal, nag

Details for d5ymsd_

PDB Entry: 5yms (more details), 2.1 Å

PDB Description: structural basis of glycan specificity and identification of a novel glycan binding cavity in human p[19] rotavirus
PDB Compounds: (D:) Outer capsid protein VP4

SCOPe Domain Sequences for d5ymsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ymsd_ b.29.1.0 (D:) automated matches {Human rotavirus a [TaxId: 10941]}
vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
ttdysttsnlneisvttyaefyiiprsqeskcteyintgl

SCOPe Domain Coordinates for d5ymsd_:

Click to download the PDB-style file with coordinates for d5ymsd_.
(The format of our PDB-style files is described here.)

Timeline for d5ymsd_:

  • d5ymsd_ is new in SCOPe 2.07-stable