Lineage for d5yj8a1 (5yj8 A:554-608)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. Protein Tudor domain-containing protein 3, TDRD3 [141201] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [189550] (3 PDB entries)
  8. Domain d5yj8a1: 5yj8 A:554-608 [351730]
    Other proteins in same PDB: d5yj8a2
    automated match to d4a4ga_
    complexed with 8w9, so4

Details for d5yj8a1

PDB Entry: 5yj8 (more details), 1.7600000000000002 Å

PDB Description: identification of a small molecule inhibitor for the tudor domain of tdrd3
PDB Compounds: (A:) Tudor domain-containing protein 3

SCOPe Domain Sequences for d5yj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yj8a1 b.34.9.1 (A:554-608) Tudor domain-containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}
mmwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpi

SCOPe Domain Coordinates for d5yj8a1 are not available.

Timeline for d5yj8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5yj8a2