Lineage for d5yj8a1 (5yj8 A:554-608)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) 
Family b.34.9.1: Tudor domain [63749] (9 proteins)
Pfam PF00567
Protein Tudor domain-containing protein 3, TDRD3 [141201] (2 species) Species Human (Homo sapiens) [TaxId:9606] [189550] (3 PDB entries) 
Domain d5yj8a1: 5yj8 A:554-608 [351730]
Other proteins in same PDB: d5yj8a2
automated match to d4a4ga_
complexed with 8w9, so4
Details for d5yj8a1
PDB Entry: 5yj8 (more details), 1.76 Å
PDB Description: identification of a small molecule inhibitor for the tudor domain of tdrd3
PDB Compounds: (A:) Tudor domain-containing protein 3SCOPe Domain Sequences for d5yj8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yj8a1 b.34.9.1 (A:554-608) Tudor domain-containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}
mmwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpi
SCOPe Domain Coordinates for d5yj8a1:
Click to download the PDB-style file with coordinates for d5yj8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5yj8a1:
- d5yj8a1 first appeared in SCOPe 2.07
View in 3D
