![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
![]() | Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
![]() | Protein Tudor domain-containing protein 3, TDRD3 [141201] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189550] (3 PDB entries) |
![]() | Domain d5yj8a1: 5yj8 A:554-608 [351730] Other proteins in same PDB: d5yj8a2 automated match to d4a4ga_ complexed with 8w9, so4 |
PDB Entry: 5yj8 (more details), 1.76 Å
SCOPe Domain Sequences for d5yj8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yj8a1 b.34.9.1 (A:554-608) Tudor domain-containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} mmwkpgdecfalywednkfyraevealhssgmtavvkfidygnyeevllsnikpi
Timeline for d5yj8a1: