Lineage for d5ysea1 (5yse A:35-414)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (160 species)
    not a true protein
  7. 2915671Species Listeria innocua [TaxId:272626] [351713] (4 PDB entries)
  8. 2915672Domain d5ysea1: 5yse A:35-414 [351720]
    Other proteins in same PDB: d5ysea2, d5yseb2
    automated match to d2zyma_
    complexed with mg, mpd

Details for d5ysea1

PDB Entry: 5yse (more details), 1.6 Å

PDB Description: crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotetraose
PDB Compounds: (A:) Lin1841 protein

SCOPe Domain Sequences for d5ysea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ysea1 c.94.1.0 (A:35-414) automated matches {Listeria innocua [TaxId: 272626]}
kvlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavasksgpdvvqmg
ttwmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwyaetrvlfyr
tdllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgrqngsplfdk
dgtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfmsgpwmvntlk
dtapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsqpdvqlswlk
dtnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygksweqiyrgg
advqtqmdtfndqveallkk

SCOPe Domain Coordinates for d5ysea1:

Click to download the PDB-style file with coordinates for d5ysea1.
(The format of our PDB-style files is described here.)

Timeline for d5ysea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ysea2