![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
![]() | Domain d5vm4g1: 5vm4 G:5-129 [351718] Other proteins in same PDB: d5vm4a2, d5vm4b2, d5vm4c2, d5vm4d2, d5vm4e2, d5vm4f2, d5vm4g2, d5vm4h2, d5vm4i2, d5vm4j2, d5vm4k2, d5vm4l2 automated match to d4w81a_ complexed with act, fmt |
PDB Entry: 5vm4 (more details), 1.9 Å
SCOPe Domain Sequences for d5vm4g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vm4g1 b.1.1.1 (G:5-129) automated matches {Llama (Lama glama) [TaxId: 9844]} klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg tqvtv
Timeline for d5vm4g1: