Lineage for d6ewqd_ (6ewq D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 3051589Species Streptococcus pneumoniae [TaxId:170187] [351651] (3 PDB entries)
  8. 3051648Domain d6ewqd_: 6ewq D: [351710]
    automated match to d4zasa_
    complexed with plp

Details for d6ewqd_

PDB Entry: 6ewq (more details), 2.2 Å

PDB Description: putative sugar aminotransferase spr1654 from streptococcus pneumoniae, plp-form
PDB Compounds: (D:) putative capsular polysaccharide biosynthesis protein

SCOPe Domain Sequences for d6ewqd_:

Sequence, based on SEQRES records: (download)

>d6ewqd_ c.67.1.0 (D:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
nynipfsppditeaeitevvdtlrsgwittgpktkelerrlslytqtpktvclnsataal
elilrvlevgpgdevivpamtytascsvithvgatpvmvdiqadtfemdydlleqaitek
tkviipvelagivcdydrlfqvvekkrdfftasskwqkafnrivivsdsahalgstykgq
psgsiadftsfsfhavknfttaeggsatwkanpviddeemykefqilslhgqtkdalakm
qlgsweydivtpaykcnmtdimaslglvqldrypsllqrrkdivdrydsgfagsrihpla
hktetvessrhlyitrvegasleernliiqelakagiasnvhykplplltayknlgfdmt
nypkayaffeneitlplhtklsdeevdyiietfktvsekvltl

Sequence, based on observed residues (ATOM records): (download)

>d6ewqd_ c.67.1.0 (D:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
nynipfsppditeaeitevvdtlrsgwittgpktkelerrlslytqtpktvclnsataal
elilrvlevgpgdevivpamtytascsvithvgatpvmvdiqadtfemdydlleqaitek
tkviipvelagivcdydrlfqvvekkrdfftasskwqkafnrivivsdsahalgstykgq
psgsiadftsfsfhavknfttaeggsatwkanpviddeemykefqilslhgqtgsweydi
vtpaykcnmtdimaslglvqldrypsllqrrkdivdrydsgfagsrihplahktetvess
rhlyitrvegasleernliiqelakagiasnvhykplplltayknlgfdmtnypkayaff
eneitlplhtklsdeevdyiietfktvsekvltl

SCOPe Domain Coordinates for d6ewqd_:

Click to download the PDB-style file with coordinates for d6ewqd_.
(The format of our PDB-style files is described here.)

Timeline for d6ewqd_:

  • d6ewqd_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-03