Lineage for d5ymtc_ (5ymt C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781109Species Human rotavirus a [TaxId:10941] [187643] (15 PDB entries)
  8. 2781140Domain d5ymtc_: 5ymt C: [351703]
    automated match to d5gj6a_
    complexed with gal, glc, nag

Details for d5ymtc_

PDB Entry: 5ymt (more details), 2.2 Å

PDB Description: functional and structural characterization of p[19] rotavirus vp8* interaction with histo-blood group antigens
PDB Compounds: (C:) Outer capsid protein VP4

SCOPe Domain Sequences for d5ymtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ymtc_ b.29.1.0 (C:) automated matches {Human rotavirus a [TaxId: 10941]}
vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
ttdysttsnlneisvttyaefyiiprsqeskcteyintgl

SCOPe Domain Coordinates for d5ymtc_:

Click to download the PDB-style file with coordinates for d5ymtc_.
(The format of our PDB-style files is described here.)

Timeline for d5ymtc_: