Lineage for d5xcwx_ (5xcw X:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. Protein automated matches [190215] (38 species)
    not a true protein
  7. Species Haemophilus influenzae [TaxId:71421] [276702] (8 PDB entries)
  8. Domain d5xcwx_: 5xcw X: [351702]
    automated match to d4lmaa_
    mutant

Details for d5xcwx_

PDB Entry: 5xcw (more details), 1.8900000000000001 Å

PDB Description: crystal structure of m92a-m120a double mutant of o-acetyl-l-serine sulfhydrylase from haemophilus influenzae
PDB Compounds: (X:) Cysteine synthase

SCOPe Domain Sequences for d5xcwx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xcwx_ c.79.1.0 (X:) automated matches {Haemophilus influenzae [TaxId: 71421]}
aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk
gkeivdatsgntgialayvaaargykitltapetmslerkrllcglgvnlvltegakgak
gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs
itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls
iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa
serylstalf

SCOPe Domain Coordinates for d5xcwx_ are not available.

Timeline for d5xcwx_: