Lineage for d1at1c1 (1at1 C:1-150)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) 
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) 
Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
Uniprot P00479
Domain d1at1c1: 1at1 C:1-150 [35170]
Other proteins in same PDB: d1at1b1, d1at1b2, d1at1d1, d1at1d2
complexed with mli, pct, zn
Details for d1at1c1
PDB Entry: 1at1 (more details), 2.8 Å
PDB Description: crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral p*h
PDB Compounds: (C:) aspartate carbamoyltransferase, catalytic chainSCOPe Domain Sequences for d1at1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1at1c1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqqteg
SCOPe Domain Coordinates for d1at1c1:
Click to download the PDB-style file with coordinates for d1at1c1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1at1c1:
View in 3D
