Lineage for d5xjlg_ (5xjl G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787534Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries)
  8. 2787537Domain d5xjlg_: 5xjl G: [351698]
    Other proteins in same PDB: d5xjla_, d5xjlb_
    automated match to d3jb9j_

Details for d5xjlg_

PDB Entry: 5xjl (more details), 2.5 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1/d2/f/e/g from human
PDB Compounds: (G:) Small nuclear ribonucleoprotein G

SCOPe Domain Sequences for d5xjlg_:

Sequence, based on SEQRES records: (download)

>d5xjlg_ b.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirgnsi
imlea

Sequence, based on observed residues (ATOM records): (download)

>d5xjlg_ b.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgnnigmvvirgnsiim
lea

SCOPe Domain Coordinates for d5xjlg_:

Click to download the PDB-style file with coordinates for d5xjlg_.
(The format of our PDB-style files is described here.)

Timeline for d5xjlg_: