Lineage for d6g47b_ (6g47 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386769Family b.21.1.0: automated matches [191353] (1 protein)
    not a true family
  6. 2386770Protein automated matches [190378] (9 species)
    not a true protein
  7. 2386818Species Human adenovirus 52 [TaxId:332179] [270156] (2 PDB entries)
  8. 2386820Domain d6g47b_: 6g47 B: [351670]
    automated match to d4k6ta_
    complexed with mpd, mrd, sia, trs

Details for d6g47b_

PDB Entry: 6g47 (more details), 1.5 Å

PDB Description: crystal structure of human adenovirus 52 short fiber knob in complex with alpha-(2,8)-trisialic acid (dp3)
PDB Compounds: (B:) Fiber-1

SCOPe Domain Sequences for d6g47b_:

Sequence, based on SEQRES records: (download)

>d6g47b_ b.21.1.0 (B:) automated matches {Human adenovirus 52 [TaxId: 332179]}
iqtlwtpptsnpnctvytesdsllslcltkcgahvlgsvsltgvagtmtnmaetslaief
tfddtgkllhsplvnntfsirqgdspasnptynalafmpnstlyarggsgeprnnyyvqt
ylrgnvqrpitltvtfnsaatgyslsfkwtavvrekfaapatsfcyiteq

Sequence, based on observed residues (ATOM records): (download)

>d6g47b_ b.21.1.0 (B:) automated matches {Human adenovirus 52 [TaxId: 332179]}
iqtlwtpptsnpnctvytesdsllslcltkcgahvlgsvsltgvagtmtnmaetslaief
tfddtgkllhsplvnntfsirqnalafmpnstlyarggsgeprnnyyvqtylrgnvqrpi
tltvtfnsaatgyslsfkwtavvrekfaapatsfcyiteq

SCOPe Domain Coordinates for d6g47b_:

Click to download the PDB-style file with coordinates for d6g47b_.
(The format of our PDB-style files is described here.)

Timeline for d6g47b_: