SCOPe 2.08: Domain d6g47a_: 6g47 A:

Lineage for d6g47a_ (6g47 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.0: automated matches [191353] (1 protein)
   not a true family

6. Protein automated matches [190378] (9 species)
   not a true protein

7. Species Human adenovirus 52 [TaxId:332179] [270156] (2 PDB entries)

8. Domain d6g47a_: 6g47 A: [351669]
   automated match to d4k6ta_
   complexed with mpd, mrd, sia, trs

Details for d6g47a_

PDB Entry: 6g47, 1.5 Å

PDB Description: crystal structure of human adenovirus 52 short fiber knob in complex with alpha-(2,8)-trisialic acid (dp3)

PDB Compounds: (A:) Fiber-1

SCOPe Domain Sequences for d6g47a_:

Sequence; same for both SEQRES and ATOM records:

>d6g47a_ b.21.1.0 (A:) automated matches {Human adenovirus 52 [TaxId: 332179]}
giqtlwtpptsnpnctvytesdsllslcltkcgahvlgsvsltgvagtmtnmaetslaie
ftfddtgkllhsplvnntfsirqgdspasnptynalafmpnstlyarggsgeprnnyyvq
tylrgnvqrpitltvtfnsaatgyslsfkwtavvrekfaapatsfcyiteq

Timeline for d6g47a_:

• d6g47a_ first appeared in SCOPe 2.07