Lineage for d6ewqa_ (6ewq A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505584Species Streptococcus pneumoniae [TaxId:170187] [351651] (3 PDB entries)
  8. 2505587Domain d6ewqa_: 6ewq A: [351658]
    automated match to d4zasa_
    complexed with plp

Details for d6ewqa_

PDB Entry: 6ewq (more details), 2.2 Å

PDB Description: putative sugar aminotransferase spr1654 from streptococcus pneumoniae, plp-form
PDB Compounds: (A:) putative capsular polysaccharide biosynthesis protein

SCOPe Domain Sequences for d6ewqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ewqa_ c.67.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
ynipfsppditeaeitevvdtlrsgwittgpktkelerrlslytqtpktvclnsataale
lilrvlevgpgdevivpamtytascsvithvgatpvmvdiqadtfemdydlleqaitekt
kviipvelagivcdydrlfqvvekkrdfftasskwqkafnrivivsdsahalgstykgqp
sgsiadftsfsfhavknfttaeggsatwkanpviddeemykefqilslhgqtkdalakmq
lgsweydivtpaykcnmtdimaslglvqldrypsllqrrkdivdrydsgfagsrihplah
ktetvessrhlyitrvegasleernliiqelakagiasnvhykplplltayknlgfdmtn
ypkayaffeneitlplhtklsdeevdyiietfktvsekvlt

SCOPe Domain Coordinates for d6ewqa_:

Click to download the PDB-style file with coordinates for d6ewqa_.
(The format of our PDB-style files is described here.)

Timeline for d6ewqa_: