Lineage for d6ewjd_ (6ewj D:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. Protein automated matches [190151] (165 species)
    not a true protein
  7. Species Streptococcus pneumoniae [TaxId:170187] [351651] (3 PDB entries)
  8. Domain d6ewjd_: 6ewj D: [351652]
    automated match to d4zasa_

Details for d6ewjd_

PDB Entry: 6ewj (more details), 1.9 Å

PDB Description: putative sugar aminotransferase spr1654 from streptococcus pneumoniae, apo-form
PDB Compounds: (D:) putative capsular polysaccharide biosynthesis protein

SCOPe Domain Sequences for d6ewjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ewjd_ c.67.1.0 (D:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
ynipfsppditeaeitevvdtlrsgwittgpktkelerrlslytqtpktvclnsataale
lilrvlevgpgdevivpamtytascsvithvgatpvmvdiqadtfemdydlleqaitekt
kviipvelagivcdydrlfqvvekkrdfftasskwqkafnrivivsdsahalgstykgqp
sgsiadftsfsfhavknfttaeggsatwkanpviddeemykefqilslhgqtkdalakmq
lgsweydivtpaykcnmtdimaslglvqldrypsllqrrkdivdrydsgfagsrihplah
ktetvessrhlyitrvegasleernliiqelakagiasnvhykplplltayknlgfdmtn
ypkayaffeneitlplhtklsdeevdyiietfktvsekvlt

SCOPe Domain Coordinates for d6ewjd_ are not available.

Timeline for d6ewjd_:

Domains from other chains:
(mouse over for more information)
d6ewja_, d6ewjb_, d6ewjc_