Lineage for d6d46a3 (6d46 A:249-381)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977468Species Rickettsia typhi [TaxId:257363] [351643] (1 PDB entry)
  8. 2977471Domain d6d46a3: 6d46 A:249-381 [351648]
    Other proteins in same PDB: d6d46a4
    automated match to d5w7za3
    complexed with cl, pg4

Details for d6d46a3

PDB Entry: 6d46 (more details), 2 Å

PDB Description: crystal structure of a dna polymerase iii subunit beta dnan sliding clamp from rickettsia typhi str. wilmington
PDB Compounds: (A:) Beta sliding clamp

SCOPe Domain Sequences for d6d46a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d46a3 d.131.1.0 (A:249-381) automated matches {Rickettsia typhi [TaxId: 257363]}
safipkssisklvinrkifadsieriaiitvekfraiklslsrktleisavgeargnake
iitasqdkesfyeyncdeslvigfnpqyledvlkavksnlvelyfsdisasapvlikfpq
npkdifvimpvkv

SCOPe Domain Coordinates for d6d46a3:

Click to download the PDB-style file with coordinates for d6d46a3.
(The format of our PDB-style files is described here.)

Timeline for d6d46a3: