| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
| Protein automated matches [226907] (28 species) not a true protein |
| Species Rickettsia typhi [TaxId:257363] [351643] (1 PDB entry) |
| Domain d6d46a2: 6d46 A:123-248 [351645] Other proteins in same PDB: d6d46a4 automated match to d5w7za2 complexed with cl, pg4 |
PDB Entry: 6d46 (more details), 2 Å
SCOPe Domain Sequences for d6d46a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d46a2 d.131.1.0 (A:123-248) automated matches {Rickettsia typhi [TaxId: 257363]}
kpevsfkiscadfakiiestkfsisldetrynlngiylhikdkeffaastdghrlsiswi
tleekiknfgvilpqksaeeilkivkdlknihedieillssnkikficnentillsklid
gtfpdy
Timeline for d6d46a2: