SCOPe 2.08: Domain d6d46a2: 6d46 A:123-248

Lineage for d6d46a2 (6d46 A:123-248)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Rickettsia typhi [TaxId:257363] [351643] (1 PDB entry)

8. Domain d6d46a2: 6d46 A:123-248 [351645]
   Other proteins in same PDB: d6d46a4
   automated match to d5w7za2
   complexed with cl, pg4

Details for d6d46a2

PDB Entry: 6d46, 2 Å

PDB Description: crystal structure of a dna polymerase iii subunit beta dnan sliding clamp from rickettsia typhi str. wilmington

PDB Compounds: (A:) Beta sliding clamp

SCOPe Domain Sequences for d6d46a2:

Sequence; same for both SEQRES and ATOM records:

>d6d46a2 d.131.1.0 (A:123-248) automated matches {Rickettsia typhi [TaxId: 257363]}
kpevsfkiscadfakiiestkfsisldetrynlngiylhikdkeffaastdghrlsiswi
tleekiknfgvilpqksaeeilkivkdlknihedieillssnkikficnentillsklid
gtfpdy

Timeline for d6d46a2:

• d6d46a2 first appeared in SCOPe 2.07