SCOPe 2.04: Domain d8at1a1: 8at1 A:1-150

Lineage for d8at1a1 (8at1 A:1-150)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)

7. Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
   Uniprot P00479

8. Domain d8at1a1: 8at1 A:1-150 [35164]
   Other proteins in same PDB: d8at1b1, d8at1b2, d8at1d1, d8at1d2
   complexed with ctp, mal, pct, zn

Details for d8at1a1

PDB Entry: 8at1, 2.8 Å

PDB Description: crystal structures of aspartate carbamoyltransferase ligated with phosphonoacetamide, malonate, and ctp or atp at 2.8-angstroms resolution and neutral p*h

PDB Compounds: (A:) aspartate carbamoyltransferase (r state), catalytic chain

SCOPe Domain Sequences for d8at1a1:

Sequence; same for both SEQRES and ATOM records:

>d8at1a1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqqteg

Timeline for d8at1a1:

• d8at1a1 first appeared (with stable ids) in SCOP 1.55
  
• d8at1a1 appears in SCOPe 2.03
  
• d8at1a1 appears in SCOPe 2.05
  
• d8at1a1 appears in the current release, SCOPe 2.08