Lineage for d6c7ya1 (6c7y A:869-1153)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. Domain d6c7ya1: 6c7y A:869-1153 [351630]
    Other proteins in same PDB: d6c7ya2
    automated match to d4fk6a_
    complexed with act, adp, edo, mg

Details for d6c7ya1

PDB Entry: 6c7y (more details), 2.5 Å

PDB Description: crystal structure of inhibitory protein socs1 in complex with jak1 kinase domain
PDB Compounds: (A:) Tyrosine-protein kinase JAK1

SCOPe Domain Sequences for d6c7ya1:

Sequence, based on SEQRES records: (download)

>d6c7ya1 d.144.1.0 (A:869-1153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkpesggnhiadlkkeiei
lrnlyhenivkykgictedggngiklimeflpsgslkeylpknknkinlkqqlkyavqic
kgmdylgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdkeyytvkddrdspvfwy
apeclmqskfyiasdvwsfgvtlhelltycdsdsspmalflkmigpthgqmtvtrlvntl
kegkrlpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeall

Sequence, based on observed residues (ATOM records): (download)

>d6c7ya1 d.144.1.0 (A:869-1153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hfekrflkrirdlgeghfgkvelcrygdntgeqvavkslkphiadlkkeieilrnlyhen
ivkykgictegiklimeflpsgslkeylpknknkinlkqqlkyavqickgmdylgsrqyv
hrdlaarnvlvesehqvkigdfgltkaietdkeyytvkddrdspvfwyapeclmqskfyi
asdvwsfgvtlhelltycdsdsspmalflkmigpthgqmtvtrlvntlkegkrlpcppnc
pdevyqlmrkcwefqpsnrtsfqnliegfeall

SCOPe Domain Coordinates for d6c7ya1 are not available.

Timeline for d6c7ya1:

Domains from same chain:
(mouse over for more information)
d6c7ya2