SCOPe 2.07: Domain d6bpla2: 6bpl A:329-579

Lineage for d6bpla2 (6bpl A:329-579)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [351626] (2 PDB entries)

8. Domain d6bpla2: 6bpl A:329-579 [351629]
   Other proteins in same PDB: d6bpla1, d6bplb1
   automated match to d3b60a1
   complexed with 3pe, au7, dao, dpo, ftt, gcs, glc, gmh, kdo, myr, pa1, po4

Details for d6bpla2

PDB Entry: 6bpl, 2.91 Å

PDB Description: e. coli msba in complex with lps and inhibitor g907

PDB Compounds: (A:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d6bpla2:

Sequence; same for both SEQRES and ATOM records:

>d6bpla2 c.37.1.0 (A:329-579) automated matches {Escherichia coli [TaxId: 83334]}
degkrvieratgdvefrnvtftypgrdvpalrninlkipagktvalvgrsgsgkstiasl
itrfydidegeilmdghdlreytlaslrnqvalvsqnvhlfndtvanniayarteqysre
qieeaarmayamdfinkmdngldtvigengvllsggqrqriaiarallrdspilildeat
saldteseraiqaaldelqknrtslviahrlstiekadeivvvedgvivergthndlleh
rgvyaqlhkmq

Timeline for d6bpla2:

• d6bpla2 is new in SCOPe 2.07-stable
  
• d6bpla2 appears in the current release, SCOPe 2.08