Lineage for d1raac1 (1raa C:1-150)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 249567Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudodyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 249568Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 249569Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 249570Protein Aspartate carbamoyltransferase catalytic subunit [53673] (3 species)
  7. 249581Species Escherichia coli [TaxId:562] [53674] (29 PDB entries)
  8. 249642Domain d1raac1: 1raa C:1-150 [35162]
    Other proteins in same PDB: d1raab1, d1raab2, d1raad1, d1raad2

Details for d1raac1

PDB Entry: 1raa (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1raac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raac1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOP Domain Coordinates for d1raac1:

Click to download the PDB-style file with coordinates for d1raac1.
(The format of our PDB-style files is described here.)

Timeline for d1raac1: