Lineage for d6c2ha_ (6c2h A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2515225Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2515226Protein automated matches [190215] (38 species)
    not a true protein
  7. 2515403Species Saccharomyces cerevisiae [TaxId:559292] [351401] (4 PDB entries)
  8. 2515405Domain d6c2ha_: 6c2h A: [351615]
    automated match to d5jisa_
    complexed with act, ca, cl, edo, na, peg, pge, plp

Details for d6c2ha_

PDB Entry: 6c2h (more details), 1.49 Å

PDB Description: crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the catalytic core
PDB Compounds: (A:) cystathionine beta-synthase

SCOPe Domain Sequences for d6c2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c2ha_ c.79.1.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
seqqadsrhnvidlvgntplialkklpkalgikpqiyaklelynpggsikdriaksmvee
aeasgrihpsrstlieptsgntgiglaligaikgyrtiitlpekmsnekvsvlkalgaei
irtptaaawdspeshigvakklekeipgavildqynnmmnpeahyfgtgreiqrqledln
lfdnlravvagagtggtisgiskylkeqndkiqivgadpfgsilaqpenlnktditdykv
egigydfvpqvldrklidvwyktddkpsfkyarqlisnegvlvggssgsaftavvkyced
hpelteddvivaifpdsirsyltkfvddewlkknnlwdddvlarf

SCOPe Domain Coordinates for d6c2ha_:

Click to download the PDB-style file with coordinates for d6c2ha_.
(The format of our PDB-style files is described here.)

Timeline for d6c2ha_: