Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [351401] (4 PDB entries) |
Domain d6c2ha_: 6c2h A: [351615] automated match to d5jisa_ complexed with act, ca, cl, edo, na, peg, pge, plp |
PDB Entry: 6c2h (more details), 1.49 Å
SCOPe Domain Sequences for d6c2ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c2ha_ c.79.1.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} seqqadsrhnvidlvgntplialkklpkalgikpqiyaklelynpggsikdriaksmvee aeasgrihpsrstlieptsgntgiglaligaikgyrtiitlpekmsnekvsvlkalgaei irtptaaawdspeshigvakklekeipgavildqynnmmnpeahyfgtgreiqrqledln lfdnlravvagagtggtisgiskylkeqndkiqivgadpfgsilaqpenlnktditdykv egigydfvpqvldrklidvwyktddkpsfkyarqlisnegvlvggssgsaftavvkyced hpelteddvivaifpdsirsyltkfvddewlkknnlwdddvlarf
Timeline for d6c2ha_: