Lineage for d5z5da2 (5z5d A:311-510)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390541Species Geobacillus thermoleovorans [TaxId:33941] [351578] (4 PDB entries)
  8. 2390542Domain d5z5da2: 5z5d A:311-510 [351609]
    Other proteins in same PDB: d5z5da1
    automated match to d1yrza1
    complexed with ca, gol

Details for d5z5da2

PDB Entry: 5z5d (more details), 1.7 Å

PDB Description: crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from geobacillus thermoleovorans it-08
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d5z5da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z5da2 b.29.1.0 (A:311-510) automated matches {Geobacillus thermoleovorans [TaxId: 33941]}
eiieddfnsdifstdwnfiqnprlehyslkgrpswlkmrgtektlndinsptfigrrqeh
fvcnvstllefkpnqdneeagltvymnekhhyeialtkkngrinvvlkktvgdiqvvvns
leyfsntiifsiqanpeeykfsfvdpntgqtyllgtglttllstevaggftgvyfglyat
gngkvctapaffdwfkyipe

SCOPe Domain Coordinates for d5z5da2:

Click to download the PDB-style file with coordinates for d5z5da2.
(The format of our PDB-style files is described here.)

Timeline for d5z5da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5z5da1