Lineage for d5z5da1 (5z5d A:1-304)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397987Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2397997Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2398164Family b.67.2.0: automated matches [227228] (1 protein)
    not a true family
  6. 2398165Protein automated matches [226971] (5 species)
    not a true protein
  7. 3051514Species Geobacillus thermoleovorans [TaxId:33941] [351576] (4 PDB entries)
  8. 3051546Domain d5z5da1: 5z5d A:1-304 [351608]
    Other proteins in same PDB: d5z5da2
    automated match to d1yrza2
    complexed with ca, gol

Details for d5z5da1

PDB Entry: 5z5d (more details), 1.7 Å

PDB Description: crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from geobacillus thermoleovorans it-08
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d5z5da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z5da1 b.67.2.0 (A:1-304) automated matches {Geobacillus thermoleovorans [TaxId: 33941]}
meysnpvikgfypdpsicrvgsdyylvtssfqyfpgvpifhstnlinwnkigyclirpsq
lmlnnatnrsgifaptlryhegifylittnvtlkknfivmsedlqgewsepiwidgwggi
dpslffdndgkvyitgtndnargeelgiyqaeidlkkgsiigerkliwkgtggsypeaph
lykvngwyylliaeggteyghmvtvarskypfgpfescpfnpilthrstnhplqaighad
ivqyhdgswwavfhgtrpisyppkhhlgretclapikwtddgwpiigyngridikmdagy
lpvk

SCOPe Domain Coordinates for d5z5da1:

Click to download the PDB-style file with coordinates for d5z5da1.
(The format of our PDB-style files is described here.)

Timeline for d5z5da1:

  • d5z5da1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5z5da2