Lineage for d5xtva2 (5xtv A:335-531)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. Protein automated matches [227126] (21 species)
    not a true protein
  7. Species Scheffersomyces stipitis [TaxId:322104] [328848] (25 PDB entries)
  8. Domain d5xtva2: 5xtv A:335-531 [351606]
    Other proteins in same PDB: d5xtva3
    automated match to d1gpua2
    complexed with 8ef, ca, peg

Details for d5xtva2

PDB Entry: 5xtv (more details), 0.93 Å

PDB Description: crystal structure of transketolase in complex with tpp intermediate v from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5xtva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xtva2 c.36.1.0 (A:335-531) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
lpenwdkalpvytpadaavatrklseivlskiipevpeiiggsadltpsnltkakgtvdf
qpaatglgdysgryirygvrehamgaimngiaafganyknyggtflnfvsyaagavrlsa
lsefpitwvathdsiglgedgpthqpietlahfratpnisvwrpadgnetsaayksaies
thtphilaltrqnlpql

SCOPe Domain Coordinates for d5xtva2 are not available.

Timeline for d5xtva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5xtva1, d5xtva3