SCOPe 2.08: Domain d6g74a1: 6g74 A:1-298

Lineage for d6g74a1 (6g74 A:1-298)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.145: NadA-like [142753] (1 superfamily)
   duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134

4. Superfamily c.145.1: NadA-like [142754] (2 families)
   automatically mapped to Pfam PF02445

5. Family c.145.1.0: automated matches [238306] (1 protein)
   not a true family

6. Protein automated matches [238307] (1 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [238308] (15 PDB entries)

8. Domain d6g74a1: 6g74 A:1-298 [351603]
   Other proteins in same PDB: d6g74a2, d6g74b2
   automated match to d4p3xa_
   complexed with pht, sf4

Details for d6g74a1

PDB Entry: 6g74, 2 Å

PDB Description: structure of the y21f variant of quinolinate synthase in complex with phthalate

PDB Compounds: (A:) Quinolinate synthase A

SCOPe Domain Sequences for d6g74a1:

Sequence; same for both SEQRES and ATOM records:

>d6g74a1 c.145.1.0 (A:1-298) automated matches {Thermotoga maritima [TaxId: 243274]}
mvdeilklkkekgyiilahnfqipelqdiadfvgdslqlarkamelsekkilflgvdfma
elvkilnpdkkvivpdrsatcpmanrltpeiireyrekfpdapvvlyvnstsecktladv
ictsanavevvkkldssvvifgpdrnlgeyvaektgkkvitipenghcpvhqfnaesida
vrkkypdakvivhpecpkpvrdkadyvgstgqmekiperdpsrifvigteigmihklkkk
fpdrefvplemavcvnmkkntlentlhalqtesfevilpkeviekakkpilrmfelmg

Timeline for d6g74a1:

• d6g74a1 first appeared in SCOPe 2.07