Lineage for d5z5ha2 (5z5h A:311-510)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (57 species)
    not a true protein
  7. 3051516Species Geobacillus thermoleovorans [TaxId:33941] [351578] (4 PDB entries)
  8. 3051537Domain d5z5ha2: 5z5h A:311-510 [351599]
    Other proteins in same PDB: d5z5ha1
    automated match to d1yrza1
    complexed with ca, xys

Details for d5z5ha2

PDB Entry: 5z5h (more details), 1.9 Å

PDB Description: crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from geobacillus thermoleovorans it-08 in complex with d-xylose
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d5z5ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z5ha2 b.29.1.0 (A:311-510) automated matches {Geobacillus thermoleovorans [TaxId: 33941]}
eiieddfnsdifstdwnfiqnprlehyslkgrpswlkmrgtektlndinsptfigrrqeh
fvcnvstllefkpnqdneeagltvymnekhhyeialtkkngrinvvlkktvgdiqvvvns
leyfsntiifsiqanpeeykfsfvdpntgqtyllgtglttllstevaggftgvyfglyat
gngkvctapaffdwfkyipe

SCOPe Domain Coordinates for d5z5ha2:

Click to download the PDB-style file with coordinates for d5z5ha2.
(The format of our PDB-style files is described here.)

Timeline for d5z5ha2:

  • d5z5ha2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5z5ha1