SCOPe 2.08: Domain d5z5ha2: 5z5h A:311-510

Lineage for d5z5ha2 (5z5h A:311-510)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Geobacillus thermoleovorans [TaxId:33941] [351578] (4 PDB entries)

8. Domain d5z5ha2: 5z5h A:311-510 [351599]
   Other proteins in same PDB: d5z5ha1
   automated match to d1yrza1
   complexed with ca, xys

Details for d5z5ha2

PDB Entry: 5z5h, 1.9 Å

PDB Description: crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from geobacillus thermoleovorans it-08 in complex with d-xylose

PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d5z5ha2:

Sequence; same for both SEQRES and ATOM records:

>d5z5ha2 b.29.1.0 (A:311-510) automated matches {Geobacillus thermoleovorans [TaxId: 33941]}
eiieddfnsdifstdwnfiqnprlehyslkgrpswlkmrgtektlndinsptfigrrqeh
fvcnvstllefkpnqdneeagltvymnekhhyeialtkkngrinvvlkktvgdiqvvvns
leyfsntiifsiqanpeeykfsfvdpntgqtyllgtglttllstevaggftgvyfglyat
gngkvctapaffdwfkyipe

Timeline for d5z5ha2:

• d5z5ha2 first appeared in SCOPe 2.07