![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
![]() | Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries) |
![]() | Domain d6ff9d_: 6ff9 D: [351589] automated match to d4xr8c_ complexed with zn; mutant |
PDB Entry: 6ff9 (more details), 2 Å
SCOPe Domain Sequences for d6ff9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ff9d_ b.2.5.2 (D:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} vpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgtr vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsv vvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvca cpgkdrrteeenl
Timeline for d6ff9d_: