![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Geobacillus thermoleovorans [TaxId:33941] [351578] (4 PDB entries) |
![]() | Domain d5z5fa2: 5z5f A:311-510 [351584] Other proteins in same PDB: d5z5fa1 automated match to d1yrza1 complexed with ca, fub |
PDB Entry: 5z5f (more details), 2.1 Å
SCOPe Domain Sequences for d5z5fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z5fa2 b.29.1.0 (A:311-510) automated matches {Geobacillus thermoleovorans [TaxId: 33941]} eiieddfnsdifstdwnfiqnprlehyslkgrpswlkmrgtektlndinsptfigrrqeh fvcnvstllefkpnqdneeagltvymnekhhyeialtkkngrinvvlkktvgdiqvvvns leyfsntiifsiqanpeeykfsfvdpntgqtyllgtglttllstevaggftgvyfglyat gngkvctapaffdwfkyipe
Timeline for d5z5fa2: