Lineage for d1radc1 (1rad C:1-150)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386472Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1386473Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 1386474Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 1386475Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)
  7. 1386483Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. 1386608Domain d1radc1: 1rad C:1-150 [35158]
    Other proteins in same PDB: d1radb1, d1radb2, d1radd1, d1radd2
    complexed with ctp, zn; mutant

Details for d1radc1

PDB Entry: 1rad (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity
PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d1radc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1radc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d1radc1:

Click to download the PDB-style file with coordinates for d1radc1.
(The format of our PDB-style files is described here.)

Timeline for d1radc1: