Lineage for d5z5ia2 (5z5i A:311-510)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780888Species Geobacillus thermoleovorans [TaxId:33941] [351578] (4 PDB entries)
  8. 2780889Domain d5z5ia2: 5z5i A:311-510 [351579]
    Other proteins in same PDB: d5z5ia1
    automated match to d1yrza1
    complexed with ca, fub, xyp, xys

Details for d5z5ia2

PDB Entry: 5z5i (more details), 1.7 Å

PDB Description: crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from geobacillus thermoleovorans it-08 in complex with l-arabinose and d-xylose
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d5z5ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z5ia2 b.29.1.0 (A:311-510) automated matches {Geobacillus thermoleovorans [TaxId: 33941]}
eiieddfnsdifstdwnfiqnprlehyslkgrpswlkmrgtektlndinsptfigrrqeh
fvcnvstllefkpnqdneeagltvymnekhhyeialtkkngrinvvlkktvgdiqvvvns
leyfsntiifsiqanpeeykfsfvdpntgqtyllgtglttllstevaggftgvyfglyat
gngkvctapaffdwfkyipe

SCOPe Domain Coordinates for d5z5ia2:

Click to download the PDB-style file with coordinates for d5z5ia2.
(The format of our PDB-style files is described here.)

Timeline for d5z5ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5z5ia1