Lineage for d6g74b1 (6g74 B:1-298)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.145: NadA-like [142753] (1 superfamily)
    duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134
  4. Superfamily c.145.1: NadA-like [142754] (2 families) (S)
    automatically mapped to Pfam PF02445
  5. Family c.145.1.0: automated matches [238306] (1 protein)
    not a true family
  6. Protein automated matches [238307] (1 species)
    not a true protein
  7. Species Thermotoga maritima [TaxId:243274] [238308] (13 PDB entries)
  8. Domain d6g74b1: 6g74 B:1-298 [351574]
    Other proteins in same PDB: d6g74a2, d6g74b2
    automated match to d4p3xa_
    complexed with pht, sf4

Details for d6g74b1

PDB Entry: 6g74 (more details), 2 Å

PDB Description: structure of the y21f variant of quinolinate synthase in complex with phthalate
PDB Compounds: (B:) Quinolinate synthase A

SCOPe Domain Sequences for d6g74b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g74b1 c.145.1.0 (B:1-298) automated matches {Thermotoga maritima [TaxId: 243274]}
mvdeilklkkekgyiilahnfqipelqdiadfvgdslqlarkamelsekkilflgvdfma
elvkilnpdkkvivpdrsatcpmanrltpeiireyrekfpdapvvlyvnstsecktladv
ictsanavevvkkldssvvifgpdrnlgeyvaektgkkvitipenghcpvhqfnaesida
vrkkypdakvivhpecpkpvrdkadyvgstgqmekiperdpsrifvigteigmihklkkk
fpdrefvplemavcvnmkkntlentlhalqtesfevilpkeviekakkpilrmfelmg

SCOPe Domain Coordinates for d6g74b1 are not available.

Timeline for d6g74b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6g74b2
View in 3D
Domains from other chains:
(mouse over for more information)
d6g74a1, d6g74a2