SCOPe 2.07: Domain d5xsub2: 5xsu B:136-349

Lineage for d5xsub2 (5xsu B:136-349)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)

8. Domain d5xsub2: 5xsu B:136-349 [351570]
   Other proteins in same PDB: d5xsua1, d5xsub1, d5xsuc1, d5xsud1
   automated match to d4hhyd2
   complexed with 8e3, so4

Details for d5xsub2

PDB Entry: 5xsu, 2.4 Å

PDB Description: novel orally efficacious inhibitors complexed with parp1

PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5xsub2:

Sequence; same for both SEQRES and ATOM records:

>d5xsub2 d.166.1.0 (B:136-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

Timeline for d5xsub2:

• d5xsub2 is new in SCOPe 2.07-stable
  
• d5xsub2 appears in the current release, SCOPe 2.08