SCOPe 2.07: Domain d6f4cb1: 6f4c B:52-324

Lineage for d6f4cb1 (6f4c B:52-324)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (33 species)
   not a true protein

7. Species Nicotiana benthamiana [TaxId:4100] [351546] (1 PDB entry)

8. Domain d6f4cb1: 6f4c B:52-324 [351547]
   Other proteins in same PDB: d6f4cb2
   automated match to d1uasa2

Details for d6f4cb1

PDB Entry: 6f4c, 2.8 Å

PDB Description: nicotiana benthamiana alpha-galactosidase

PDB Compounds: (B:) alpha-galactosidase

SCOPe Domain Sequences for d6f4cb1:

Sequence; same for both SEQRES and ATOM records:

>d6f4cb1 c.1.8.1 (B:52-324) automated matches {Nicotiana benthamiana [TaxId: 4100]}
lsnglgrtpqmgwsswnhfacnieekeiretadamvstglaslgyeyiniddcwaelnrd
sqgnmvpkgstfpsgikaladyvhskglklgiysdagsqtcskqmtgslgheeqdaktfa
swgvdylkydncnnenrsprerypimakalknsgraifyslcewgdddpatwassvgnsw
rttgdisdnwdsmtsradmndewasyagpggwndpdmlevgnggmttaeyrshfsiwala
kapliigcdlrsmdqtaheilsnkeviavnqdk

Timeline for d6f4cb1:

• d6f4cb1 is new in SCOPe 2.07-stable
  
• d6f4cb1 appears in the current release, SCOPe 2.08