Lineage for d5xsra1 (5xsr A:1-135)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321349Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2321350Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2321375Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2321376Protein automated matches [226964] (2 species)
    not a true protein
  7. 2321377Species Human (Homo sapiens) [TaxId:9606] [225405] (47 PDB entries)
  8. 3051479Domain d5xsra1: 5xsr A:1-135 [351541]
    Other proteins in same PDB: d5xsra2
    automated match to d4hhyd1
    complexed with 8ec, so4

Details for d5xsra1

PDB Entry: 5xsr (more details), 2.3 Å

PDB Description: novel orally efficacious inhibitors complexed with parp1
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5xsra1:

Sequence, based on SEQRES records: (download)

>d5xsra1 a.41.1.0 (A:1-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

Sequence, based on observed residues (ATOM records): (download)

>d5xsra1 a.41.1.0 (A:1-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
ssskdpidvnyek

SCOPe Domain Coordinates for d5xsra1:

Click to download the PDB-style file with coordinates for d5xsra1.
(The format of our PDB-style files is described here.)

Timeline for d5xsra1:

  • d5xsra1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5xsra2