Lineage for d5xsaa3 (5xsa A:532-677)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. Protein automated matches [226991] (9 species)
    not a true protein
  7. Species Scheffersomyces stipitis [TaxId:322104] [328851] (25 PDB entries)
  8. Domain d5xsaa3: 5xsa A:532-677 [351526]
    Other proteins in same PDB: d5xsaa1, d5xsaa2
    automated match to d1gpua3
    complexed with 8el, ca

Details for d5xsaa3

PDB Entry: 5xsa (more details), 0.98 Å

PDB Description: crystal structure of transketolase in complex with tpp intermediate iii from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5xsaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xsaa3 c.48.1.0 (A:532-677) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
egssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltf
dkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpe
gvaeraaktvafykgkdvvsplrsaf

SCOPe Domain Coordinates for d5xsaa3 are not available.

Timeline for d5xsaa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d5xsaa1, d5xsaa2